Live Breaking News & Updates on Vegnews Perfectdayicecream

Stay updated with breaking news from Vegnews perfectdayicecream. Get real-time updates on events, politics, business, and more. Visit us for reliable news and exclusive interviews.

Unilever Is the Latest Food Giant to Embrace Precision Fermentation

Will Ben & Jerry’s, Magnum, Talenti, Breyers, or another Unilever brand be the first to use precision fermentation, an animal-free technology that stands to transform the way dairy is produced? ....

United States , United Kingdom , San Francisco , Ben Jerry , Vegnews Magnumnondairy , Andy Sztehlo , Vegnews Newculture , Vegnews Cowsanimalag , Anna Starostinetskaya , Vegnews Ben Jerryssunflowerbutter , Vegnews Perfectdayicecream , Mars Inc , Burger King , North American , Coffee Caramel Fudge , Chocolate Fudge Brownie , Mint Chocolate Cookie , Vegetarian Butcher , California Based Perfect Day , General Mills , Perfect Day , New Culture , Senior News Editor ,

Animal-Free Milk Startup Raises $120 Million to "Liberate Food Chain from Dependency on Animals"

Remilk just raised $120 million to scale production of its animal-free milk protein which can be used to make dairy-identical cheese, ice cream, and yogurt without exploiting a single cow. ....

United Kingdom , San Francisco , United States , Pasha Romanovski , Villa Dolce , Vegnews Perfectdayicecream , Anna Starostinetskaya , Aviv Wolff , Urgent Company , Hanaco Ventures , News Remilk Cheese , California Based Perfect Day , Brave Robot , Perfect Day , Senior News Editor , Winter Wellness Issue ,

Perfect Day Raises $350 Million Ahead of IPO, Announces Dairy-Identical Cheese Label

Perfect Day Raises $350 Million Ahead of IPO, Announces Dairy-Identical Cheese Label
vegnews.com - get the latest breaking news, showbiz & celebrity photos, sport news & rumours, viral videos and top stories from vegnews.com Daily Mail and Mail on Sunday newspapers.

United States , San Francisco , Vegnews Perfectdayvegangelato , Bbob Iger , Perumal Gandhi , Anna Starostinetskaya , Paul Kollesoff , Aryan Pandya , Vegnews Modernkitchenperfectdayvegancreamcheese , Villa Dolce , Vegnews Perfectdayicecream , Brooklyn Bagelfest , Vegnews Perfectdayvegancreamcheesemodernkitchen , Urgent Company , Walt Disney Company , Arizona State University , Ocean Properties , Perfect Day , Walt Disney , Beyond Meat , Brave Robot , Modern Kitchen , Spring Onion , Harissa Pepper , Southern California , Dot Foods ,